1 2 3 4 5- X r* XK XX从 6 7 8 9 10 11 12 13 14 15 TX 16 17 18 19 20 XX 21 22 XX nibits Down syndrome pits Down syndrome es not exhibit Down syndrome
Q: Hello Heliodors! (cont.) Trait B Heliodors are either red (R), yellow (Y) or an intermediate…
A: The phenotype of an individual is defined by their genotype and expressed genes, as well as apparent…
Q: Offspring #1 (Mine) Offspring #2 (Mate's) B'B' - blue eyes ВB'- gray eyes GG' - wavy hair EE' -…
A: Introduction :- Genotype is defined as the genetic makeup of an individual organism and it is the…
Q: In the 1st image, are all gametes viable since they are parental crossovers? Also, in the 2nd…
A: In cell cycle, crossing over is the exchange of genetic material between two homologous chromosomes.…
Q: d. sex chromosome do only ma e. Shade the female offspring in the above Punnett square. Leave the…
A: A karyotype is an individual's collection of chromosomes. The term also refers to a laboratory…
Q: Phenotype Genotype Number MM LMLM 182 MN LMLN 172 NN LNLN 44 Calculate the frequency of LM allele?…
A: According to Hardy Weinbergs equilibrium- p2+q2+2pq=1 and p+q=1 Where p= frequency of the dominant…
Q: Hello! Please help me with question 10!
A: If a trait or disorder is autosomal dominant in nature, then it must pass on to the next generation.…
Q: Open with Mutation: Incomplete Wing Veins P generation Phenotypes: Normal female X Incomplete male…
A: The alleles are the alternative forms of a gene that are located on the same locus of a homologous…
Q: The human karyotype below K才其才 6 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 O results in Patau…
A: Karyotype is a total collection of the chromosomes of a organism. For suppose the karytope of humans…
Q: 1. Color blindness is a Ylinked trait. 2. Sex Linked Trait is the gene (pair) that determines a…
A: The inheritance of genetic disorders and illnesses is often transferred from parents to their…
Q: Preimplantation genetic diagnosis would be least useful in detecting adisease-causing allele.a.…
A: PGD stands for preimplantation genetic diagnosis. It is the genetic test done as part of IVF that…
Q: Which of the Pedigree Diagrams below is most likely to show a family with Becker muscular dystrophy?…
A: Becker muscular dystrophy is a genetic disease which is due to mutations in the dystrophin protein.…
Q: Mutation: Tan Body P generation Phenotypes: Normal female X Tan male F, generation Phenotvpe Females…
A: Given: P generation phenotypes: Normal female and Tan male F1 generation phenotypes: Normal females…
Q: zzle My Classes Copy ink Peoigree MULTIPLE CHOICE QUESTION 1 What clue is found in this pedigree to…
A: Traits or characteristics of an individual can be carried by autosomal or sex chromosomes in…
Q: Sex linked 6. traits are those found on the chromosomes determining gender, and show up more often…
A: Multiple allele is a condition and according to that, In a gene there are more than two alternate…
Q: Hello Heliodors! Trait B Heliodors are either red (R), yellow (Y) or an intermediate phenotype,…
A: Inheritance or heredity is passing-on one trait form the parents to the progeny by either asexual or…
Q: Long wings (W) are dominant to short wings (w). The heterozygous dominant genotype is Ww
A: A genotype refers to the combination of heritable genes present in an organism that can be…
Q: Phenotypic Number Number O-E (O-E) Class Observed expected (E) (0) Purple 87 smooth Purple 41…
A: In plant , there are two types of traits . It includes :- A ) Trait for colour B ) Trait for…
Q: VAR(Y) = oỷ = (20 – 21.49) x Pr(Y = 20} + (21 - 21.49)? x Pr{Y = 21)
A: Synsacrum is the thoracic region of the vertebral column in fowl. It consists of about 16 fused…
Q: Figure shows a dihybrid cross but it can be analyzed as a monohybrid cross of just smooth seed coat…
A: Monohybrid cross-refers to the cross occurs in the offspring of the F1 generation, which shows…
Q: Examine the karyotype. 5 6. 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 Y How would the person with…
A: A normal female has 22 pairs of autonomous chromosomes and a pair of sex chromosome consisting of X…
Q: 10. About 70% of Americans get a bitter taste form the substance called phenylthiocarbamide (PTC).…
A: The alleles are the alternative forms of a gene that are located on the same locus of a homologous…
Q: Sickle cell anemia is a recessive tralt in humans. In a cross between two parents who are…
A: Sickle cell Anaemia being an autosomal recessive disease suggests that both the copies of the gene…
Q: 10 12 5. What type of inheritance pattem is this? A utosomal recessive 6. What is the genotype of…
A: The pedigree indicates if the DNA is passed down unchanged from generation to generation. It can…
Q: Recessive Disor der Hurler Syn drome Rr RR Rr R- Rr RR rr 1, w hot is the penotype for I ?_ 2. whet…
A: X-linked recessive inheritance pattern is determined by the presence of mutated recessive trait on X…
Q: Hello Heliodors! (cont.) Trait B Heliodors are either red (R), yellow (Y) or an intermediate…
A: The option 4 is correct. i.e. 1 red :2 orange :1 yellow.
Q: man of genotype AB ab mauis a wemer oho is ablab • what š probability sthat hei fuit are two child…
A: Genes independently assort at a distance of 50 cM or more apart. Thus here the genes are linked.
Q: The allele's number for each gene :found on sex chromosomes is 9:08 AMV
A: A sex chromosome, (also referred as heterochromosome, or idiochromosome) is a chromosome that…
Q: 3 o help you understand which genetic condition could explain each athlete's test resu plete the…
A: Congenital adrenal hyperplasia results from the 21-hydroxylase deficiency is caused by the autosomal…
Q: describes an example of a maternal effect gene. Explainhow Sturtevant deduced a maternal effect gene…
A: A gene from the maternal genome gives products that are required for the early development of the…
Q: Punnett Square - Sickle Cell Heterozygous Carrier(Ss) mom mates with sickle cell affect dad (ss)…
A: The Punnett square is a squared design used to forecast genotypes in a cross or breeding study.…
Q: 6. hybrid tall X ahort Te x a 7. purobrid tunll X ahon TT x a 8. hotorozygous yollaw sood x groon…
A: Since you have posted a question with multiple sub-parts, we will solve the first three sub-parts…
Q: 7. Figure 3 shows the karyotypes of two individuals suffering from a genetic disorder. 6. 10 11 10…
A: Answer- Genetic disorder can be of two different types that is- DNA mutation Chromosomal disorder…
Q: CROSS 1: Rand Su alleles Parents are: T SuSu x RR susu Fl are: F2: Fill in the Punnett square:
A: An individual inherits two alleles, one from each parent. A pair of alleles for a trait forms the…
Q: 1. Which of the karyotypes shown is from a normal female? A XKI 10 10 12 13 10 13 14 15 10 18 88 88…
A: To find: The karyotype of normal female
Q: The human karyotype below 10 11 12 17 13 14 15 16 18 19 20 21 22 results in Patau Syndrome. O…
A: karyotype of a human There are 22 pairs of autosomal chromosomes and one pair of sex chromosomes in…
Q: KARYOTYPE #1 %3D 8 10 11 12 %3D 13 14 15 16 17 18 88 66 66 20 21 22 Y Is this karyotype male or…
A: A karyotype is the set of chromosomes that makes up an individual. A laboratory method that…
Q: 3 10 11 12 13 14 15 16 18 19 20 21 22 Y Is this karyotype male or female? Kind of error (if any).…
A: Chromosomes are long thread-like structures that carry coded genetic information in the form of DNA.…
Q: 20 Recessive traits are represented by O lower case letters capital letters ratio O percentage 21 A…
A: Dominant traits are phenotypically expressed in the offspring while recessive traits are not…
Q: 2. Phenotypic variatioh fails tỏ také ihtó áččóuht the contribution from environmental effects. True…
A: A gene is a unit of hereditary present in thousands of numbers on the helical strands of…
Q: uestions: 2 6. 1 12 13 14 15 ee above tracks a recessive sex-linked disorder locatedo he through…
A: male with a mutation in a gene on the X chromosome is typically affected with the condition. Because…
Q: a. Dominant gene DekL NORS b. Recessive gene MndFGik P c. Pure dominant AA Gg KK u pp Rr TT d. Pure…
A: Since you have asked multiple question, we will solve the first question for you. If you want any…
Q: If these segregation patterns are equally likely, what is the probability that a gamete produced by…
A: Chromosome is a compact structure of a DNA molecule wrapped around some proteins. It is generally…
Q: Lethal Epistasis Polygenic Description Cause death of the Interaction of genes One trait is organism…
A: Genes come in pairs and are responsible for the inheritance and expression of the associated…
Q: an eltner form a mustache (M) or beard (m). M IS domina RM Rm rM rm RRmm Rrmm Rm Rrmm RRMM RrMm RrMm…
A:
Q: Mutation: Curly Wing Shape P generation Phenotypes: Normal femalo X Curly male F, generation…
A: Some gene show complete dominance while some show co dominance or incomplete dominance. In complete…
Q: 5. Both parents are heterozygous (Mm x Mm) a. Part A (fill in the boxes):
A: Incomplete dominance is the type of condition in which the dominant allele is incomplete the…
Q: d. Legend Exhibits Trait Unaffected Matings Male Offspring Female The trait explored in the above…
A: True Traits from male and affected gave 1 affected male 1 unaffected male 1 affected…
Q: Hello Heliodors! (cont.) Trait C The shape of a heliodor is an X-linked trait. Male heliodors…
A: In genetics,Genes are the hereditary units of life. Genes contains two alternative forms called…
Q: ETT Squa Heterozygous Male crossed with Homozygous Dominant Female Complete the Punnett Square. Find…
A: Dominant trait occurs when present in homozygous or heterozygous condition whereas recessive trait…
Step by step
Solved in 2 steps
- Word AaBbCcI AaBb CcD AaB AaBbCсI AaBbCcL 4 1 Normal Subtitle Title 1 No Spaci... Subtle Em..... Create and Share Adobe PDF Styles Adobe Acro P 1 1 2 4 A 3. A AL T L 4 E 5 E Question 6: The largest chromosome in Mischievous gremlinus has a length of 9 x 107 base pairs. The rate of DNA synthesis is 3,000 bp per minute at each replication fork. a. How long does it take to replicate the entire chromosome from a single origin of replication located exactly in the middle of the chromosome? Assume no pauses. I b. Experiments performed by Professor Trink reveal that it takes only 20 minutes for a growing cell to replicate this chromosome. What is the minimum number of replicons present on the chromosome? Florian Fischer Find v Replace Select Editing 153 23Z File Arial Home 12 8 Type here to search Insert S W X Draw B I U ab 13 #3 3 LLJ Layout E C Review f4 D S X₂ R View O E LL x² 15 Task 6 V AAEEEE A) (1) What types of cells are produced by meiosis and mitosis? C 5 (DJ ACTUAL (c) Why is the curve at A - B steeper than the THEORETICAL line? de in (ii) Explain the significance of the difference in the number of chromosomes. (i) What are the possible uses of the cells produced from mitosis and meiosis? f6 D T G The Cell Assignmen: 22.23 - Saved 6 B 17 Y H W & 7 18 hp 7 N U 19 0 8 4 u M 10 9 Heading 1 15 K ä (A.C.2.3) F11 Heading 2 112 Mahammac Zawia Normal 9 C 7°C Mostly cloudy ^940) scroll diam 19 pause brick Share 12:00 AM 11/24/2022 insert backspace I Ę₂6. Refer to the figure answer the following questions. CLUSTAL W (1.83) multiple sequence alignment R-------WVDIALECERYLAPK 50 Human_AA Oyster AA Corn_AA -MKLFWLLFTIGFCWAQYSSN--TQQGRTSIVHLFEWR- -QVILWCLLYVGVVRGGTWSNPTCAPGRHTITHLFEWK-------WSDIAAECERFLGPM 52 MAKHLAAMCRCSLLVLVLLCLGSQLAQSQVLFQGFNWESWKKOGGWYNYLLGRVDDIAAT 60 : : : : *:*. Human AA Oyster AA Corn_AA GFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 GYCGVQISPPNENRIVTSPNRPWWERYQPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPQGYMPGRLYDLD---ASKYGTHAELKSLTAAFHAKGVKCVA 114 :: *.. ::: .:. : * Human_AA Oyster AA Corn_AA DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG---TPDSRLDWGPDMICSDDTQYSN--GRG 163 :: Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two I. one III. threel IV. four b) What does the (*) mark mean in this alignment result? I.…
- Why is 26 incorrect1_30*_SP23 - General Biology I (for majors)/1 of us page The anticodon sequence created from the following DNA: TACGGGGCTGAGATT F1 Select one: O a. Tyr-Gly-Ala-Glu-lle O b. AUGCCCCGACUCUAA c. UACGGGGCUGAGAUU O d. Met-Pro-Arg-Leu-STOP F2 # 80 F3 $ 000 000 F4 % F5 MacBook Air F6 & r F7 DII F8III. Deletion of C IV. Both I & II 6. Refer to the figure answer the following questions. CLUSTAL W (1.83) multiple sequence alignment Human_AA Oyster AA Corn_AA -MKLEWLLFTIGFCWAQYSSN--TOOGRTSIVHLFEWR-------WVDIALECERYLAPK 50 -QVILNCLLYVvGVVRGGTWSNPTCAPGRHTITHLFEWK- -WSDIAAECERFLGPM 52 MAKHLAAMCRCSLLVLVLLCLGSQLAQSOVLFOGFNWESWKKOGGWYNYLLGRVDDIAAT 60 : : : : *:*. %3: .. O Human_AA Oyster AA Corn AA GFGGVOVSPPNENVAIHNPFRPWWERYOPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 GYCGVOISPPNENRIVTSPNRFWWERYOPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPOGYMPGRLYDLD------ASKYGTHAELKSLTAAFHAKGVKCVA 114 ::*.. : ::.:. :.*: Human_AA Oyster AA Corn AA DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG------TPDSRLDWGPDMICSDDTQYSN--GRG 163 :: * ***** Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two I. one II. three IV. four b) What…
- 89949/assessments/424097/variants/623602/take/3/ Question 3 Which term describes the location of a gene on a chromosome? Homologous pair (chromosome 1) C«» 0:00 / 0:00 Edic Homologous pair (chromosome 2) Paternal copy (from father) Maternal copy (from mother) Speed: 1x A Edic Paused StreA Meet - rfc-prp x A G-Unit 5: DNA an X 4 https://docs.goog x y google classroom xP Classes cs.google.com/forms/d/e/1FAlpQLSeyPC6Kmoa0k5JJd1DWGzqqRwaQQobHN0OdqFX_aDbV_6-bKw/formResponse x New Tab D YouTube Маps E Copy of Distance Le. Launch Meeting - . 2020 HORNETS 4N. O StudentVUE 2 Mr. Nussbaum Lan. A Graphing Lines Use the chart to determine the correct amino acid that this DNA would code for - ATA * 1 point GFL E D А Y STOP Alanine U Tyrosine C. STOP Stop V Valine GU Cysteine U Stop G Tryplophan R Arginine G А С U A Leucine S. K Serine A C L UGA Lysine Proline Аsparagine M START H. I R o search 99. Serine Threonineule_2023_Spring_Stu x M Inbox (1) - Ic21-0506@lclari X =6104_EP#6 - Google Docs ent/d/104sNODGApfrUg768nDS9piPmOB-VzXs86b_t-tDcDF8/edit My Drive - Google... WebAdvisor Main... ols Extensions Zotero Help text T Arial Haplontic life cycle Diplontic life cycle Parthenogenesis Karyotype Histone - 11 + 2 4. Match the words with the correct definitions: | Alternation of generations Job Listing - USF... WT Enrollment Requir... B I U 3 4 X 0 Lecture Video: The Cell Cyc x Chemical Principl... UO UND Orn Z = - 1:3 A type of reproduction that produces a clone of the mother A protein DNA wraps around it to condense the DNA An organism alternates between 1n and 2n with each generation A complete set of chromosomes, as they appear in the nucleus When an organism spends most of its life in the 1n state When an organism spends most of its life in the 2n state 11
- Considering the following chromosome which is represented as a series of genes on each arm separated by the centromere. Describe the type of mutation required to produce each of the mutant chromosomes below. ABCDEFG*HIJKLMNView this video. List at least eight (8) different processes that affect the structure of the chromosomes. Explain in a sentence how each process happens. https://www.youtube.com/watch?v=7_p14l8gPhkBelow are the DNA sequences that encode the first eight amino acids for five alleles of the Adh protein in Drosophila pseudoobscura. Nucleotides that differ from the first sequence are shown by a lowercase letter. ATGTCTCTCACCAACAAGAACGTC ATGgCTCTCACCAACAAGAACGTC ATGTCgCTCACCAACAAGAACGTC ATGTCTtTgACCAACAAGAACGTC ATGTCTCTCACCAACAAGAACGTg a. What are the first eight amino acids for each of these five DNA sequences? b. For each of the five polymorphic sites, indicate whether the site represents a synonymous or nonsynonymous polymorphism. c.The fourth sequence shown above has two mutational differences from the first sequence. Specifically, the third codon is TTG versus CTC in the first sequence. These two codons are two mutational steps away from each other. Supposing that the CTC sequence gave rise to the TTG sequence, do you think it is more likely that the one-difference intermediate was TTC or CTG? d. In general, synonymous polymorphisms tend to be more common than nonsynonymous…